PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0223189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 294aa    MW: 32964.6 Da    PI: 9.0518
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0223189.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM92.95.1e-2957953128
              NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Lj0g3v0223189.1   5 QSDNEWFFFSPRGRKYPNGSQSKRATECGYWKATGKERNVKS-GSNVIGTKRTLVFHLGRAPKGERTEWIMHEYCI 79 
                      4689**************************************.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.377195IPR003441NAC domain
SuperFamilySSF1019412.62E-33594IPR003441NAC domain
PfamPF023653.4E-14978IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSFIQSDNEW FFFSPRGRKY PNGSQSKRAT ECGYWKATGK ERNVKSGSNV IGTKRTLVFH  60
LGRAPKGERT EWIMHEYCIN DKSQDSLVVC RLKRNTEFRL SDASNRASSS QIQPVHSHES  120
SDGGIDQSQR GLGEGAQDKE VGCSSKRSSS SYGSEQIESV SESNQRPAND GHLTESSGHL  180
KEVDEEDCYA EILKNDIIKL DESSISKAGH TIPEDPAQLD NYQGTAQRRI RLRVKRPRRS  240
AEGARCSSKM HSSKSSFFAR ITTRLVVVFA FLVFTLVGVC FWSSFGTWSR TSEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-2579470164NAC domain-containing protein 19
4dul_A1e-2579470164NAC domain-containing protein 19
1ut7_B1e-2579470164NO APICAL MERISTEM PROTEIN
1ut7_A1e-2579470164NO APICAL MERISTEM PROTEIN
1ut4_B1e-2579470164NO APICAL MERISTEM PROTEIN
1ut4_A1e-2579470164NO APICAL MERISTEM PROTEIN
3swp_D1e-2579473167NAC domain-containing protein 19
3swp_C1e-2579473167NAC domain-containing protein 19
3swp_B1e-2579473167NAC domain-containing protein 19
3swp_A1e-2579473167NAC domain-containing protein 19
3swm_D1e-2579473167NAC domain-containing protein 19
3swm_C1e-2579473167NAC domain-containing protein 19
3swm_B1e-2579473167NAC domain-containing protein 19
3swm_A1e-2579473167NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.181530.0cell culture
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1422790.0BT142279.1 Lotus japonicus clone JCVI-FLLj-14J15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003596857.11e-145NAC transcription factor-like protein
RefseqXP_013464952.11e-146NAC transcription factor-like protein
TrEMBLI3SP811e-160I3SP81_LOTJA; Uncharacterized protein
STRINGGLYMA13G39090.21e-143(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.13e-59NTM1-like 8